diff --git a/GITALY_SERVER_VERSION b/GITALY_SERVER_VERSION
index 2b0daa89dfa..d9b9e1e8226 100644
--- a/GITALY_SERVER_VERSION
+++ b/GITALY_SERVER_VERSION
@@ -1 +1 @@
-574ce1641f5de518338c2d4c7fbe17681d741363
+3ec72513ce59862f022cf5375f1d4739653f8cee
diff --git a/app/assets/javascripts/environments/components/confirm_rollback_modal.vue b/app/assets/javascripts/environments/components/confirm_rollback_modal.vue
index 58d9c428030..e7788e11ebe 100644
--- a/app/assets/javascripts/environments/components/confirm_rollback_modal.vue
+++ b/app/assets/javascripts/environments/components/confirm_rollback_modal.vue
@@ -6,7 +6,8 @@
 
 import { GlModal } from '@gitlab/ui';
 import { escape } from 'lodash';
-import { s__, sprintf } from '~/locale';
+import csrf from '~/lib/utils/csrf';
+import { __, s__, sprintf } from '~/locale';
 
 import eventHub from '../event_hub';
 
@@ -35,6 +36,11 @@ export default {
       required: false,
       default: true,
     },
+    retryUrl: {
+      type: String,
+      required: false,
+      default: null,
+    },
   },
 
   computed: {
@@ -66,6 +72,12 @@ export default {
       return this.environment.commitUrl;
     },
 
+    modalActionText() {
+      return this.environment.isLastDeployment
+        ? s__('Environments|Re-deploy')
+        : s__('Environments|Rollback');
+    },
+
     modalText() {
       const linkStart = `<a class="commit-sha mr-0" href="${escape(this.commitUrl)}">`;
       const commitId = escape(this.commitShortSha);
@@ -90,10 +102,17 @@ export default {
       );
     },
 
-    modalActionText() {
-      return this.environment.isLastDeployment
-        ? s__('Environments|Re-deploy')
-        : s__('Environments|Rollback');
+    primaryProps() {
+      let attributes = [{ variant: 'danger' }];
+
+      if (this.retryUrl) {
+        attributes = [...attributes, { 'data-method': 'post' }, { href: this.retryUrl }];
+      }
+
+      return {
+        text: this.modalActionText,
+        attributes,
+      };
     },
   },
 
@@ -114,15 +133,20 @@ export default {
       return '';
     },
   },
+  csrf,
+  cancelProps: {
+    text: __('Cancel'),
+    attributes: [{ variant: 'danger' }],
+  },
 };
 </script>
 <template>
   <gl-modal
     :title="modalTitle"
     :visible="visible"
+    :action-cancel="$options.cancelProps"
+    :action-primary="primaryProps"
     modal-id="confirm-rollback-modal"
-    :ok-title="modalActionText"
-    ok-variant="danger"
     @ok="onOk"
     @change="handleChange"
   >
diff --git a/app/assets/javascripts/environments/components/rollback_modal_manager.vue b/app/assets/javascripts/environments/components/rollback_modal_manager.vue
index 1cd46016fd2..6aa7d96fdfd 100644
--- a/app/assets/javascripts/environments/components/rollback_modal_manager.vue
+++ b/app/assets/javascripts/environments/components/rollback_modal_manager.vue
@@ -1,7 +1,5 @@
 <script>
 import { parseBoolean } from '~/lib/utils/common_utils';
-import { redirectTo } from '~/lib/utils/url_utility';
-import eventHub from '../event_hub';
 import ConfirmRollbackModal from './confirm_rollback_modal.vue';
 
 export default {
@@ -22,10 +20,6 @@ export default {
     };
   },
   mounted() {
-    eventHub.$on('rollbackEnvironment', () => {
-      redirectTo(this.retryPath);
-    });
-
     document.querySelectorAll(this.selector).forEach((button) => {
       button.addEventListener('click', (e) => {
         e.preventDefault();
@@ -57,6 +51,7 @@ export default {
     v-model="visible"
     :environment="environment"
     :has-multiple-commits="false"
+    :retry-url="retryPath"
   />
   <div v-else></div>
 </template>
diff --git a/app/assets/javascripts/packages_and_registries/package_registry/components/details/app.vue b/app/assets/javascripts/packages_and_registries/package_registry/components/details/app.vue
index 8d360cd2c28..4ab64350d26 100644
--- a/app/assets/javascripts/packages_and_registries/package_registry/components/details/app.vue
+++ b/app/assets/javascripts/packages_and_registries/package_registry/components/details/app.vue
@@ -20,7 +20,6 @@ import { numberToHumanSize } from '~/lib/utils/number_utils';
 import { objectToQuery } from '~/lib/utils/url_utility';
 import { s__, __ } from '~/locale';
 // import DependencyRow from '~/packages/details/components/dependency_row.vue';
-// import PackageListRow from '~/packages/shared/components/package_list_row.vue';
 import PackagesListLoader from '~/packages/shared/components/packages_list_loader.vue';
 import { packageTypeToTrackCategory } from '~/packages/shared/utils';
 import AdditionalMetadata from '~/packages_and_registries/package_registry/components/details/additional_metadata.vue';
@@ -28,6 +27,7 @@ import InstallationCommands from '~/packages_and_registries/package_registry/com
 import PackageFiles from '~/packages_and_registries/package_registry/components/details/package_files.vue';
 import PackageHistory from '~/packages_and_registries/package_registry/components/details/package_history.vue';
 import PackageTitle from '~/packages_and_registries/package_registry/components/details/package_title.vue';
+import VersionRow from '~/packages_and_registries/package_registry/components/details/version_row.vue';
 import {
   PACKAGE_TYPE_NUGET,
   PACKAGE_TYPE_COMPOSER,
@@ -62,7 +62,7 @@ export default {
     GlSprintf,
     PackageTitle,
     PackagesListLoader,
-    // PackageListRow,
+    VersionRow,
     // DependencyRow,
     PackageHistory,
     AdditionalMetadata,
@@ -138,7 +138,7 @@ export default {
       };
     },
     hasVersions() {
-      return this.packageEntity.versions?.length > 0;
+      return this.packageEntity.versions?.nodes?.length > 0;
     },
     packageDependencies() {
       return this.packageEntity.dependency_links || [];
@@ -154,11 +154,6 @@ export default {
     formatSize(size) {
       return numberToHumanSize(size);
     },
-    getPackageVersions() {
-      if (!this.packageEntity.versions) {
-        // this.fetchPackageVersions();
-      }
-    },
     async deletePackage() {
       const { data } = await this.$apollo.mutate({
         mutation: destroyPackageMutation,
@@ -329,24 +324,13 @@ export default {
         </p>
       </gl-tab>
 
-      <gl-tab
-        :title="__('Other versions')"
-        title-item-class="js-versions-tab"
-        @click="getPackageVersions"
-      >
+      <gl-tab :title="__('Other versions')" title-item-class="js-versions-tab">
         <template v-if="isLoading && !hasVersions">
           <packages-list-loader />
         </template>
 
         <template v-else-if="hasVersions">
-          <!-- <package-list-row
-            v-for="v in packageEntity.versions"
-            :key="v.id"
-            :package-entity="{ name: packageEntity.name, ...v }"
-            :package-link="v.id.toString()"
-            :disable-delete="true"
-            :show-package-type="false"
-          /> -->
+          <version-row v-for="v in packageEntity.versions.nodes" :key="v.id" :package-entity="v" />
         </template>
 
         <p v-else class="gl-mt-3" data-testid="no-versions-message">
diff --git a/app/assets/javascripts/packages_and_registries/package_registry/components/details/version_row.vue b/app/assets/javascripts/packages_and_registries/package_registry/components/details/version_row.vue
new file mode 100644
index 00000000000..d218a405af6
--- /dev/null
+++ b/app/assets/javascripts/packages_and_registries/package_registry/components/details/version_row.vue
@@ -0,0 +1,71 @@
+<script>
+import { GlLink, GlSprintf, GlTruncate } from '@gitlab/ui';
+import { getIdFromGraphQLId } from '~/graphql_shared/utils';
+import PackageTags from '~/packages/shared/components/package_tags.vue';
+import PublishMethod from '~/packages/shared/components/publish_method.vue';
+import ListItem from '~/vue_shared/components/registry/list_item.vue';
+import TimeAgoTooltip from '~/vue_shared/components/time_ago_tooltip.vue';
+import { PACKAGE_DEFAULT_STATUS } from '../../constants';
+
+export default {
+  name: 'PackageListRow',
+  components: {
+    GlLink,
+    GlSprintf,
+    GlTruncate,
+    PackageTags,
+    PublishMethod,
+    ListItem,
+    TimeAgoTooltip,
+  },
+  props: {
+    packageEntity: {
+      type: Object,
+      required: true,
+    },
+  },
+  computed: {
+    packageLink() {
+      return `${getIdFromGraphQLId(this.packageEntity.id)}`;
+    },
+    disabledRow() {
+      return this.packageEntity.status && this.packageEntity.status !== PACKAGE_DEFAULT_STATUS;
+    },
+  },
+};
+</script>
+
+<template>
+  <list-item :disabled="disabledRow">
+    <template #left-primary>
+      <div class="gl-display-flex gl-align-items-center gl-mr-3 gl-min-w-0">
+        <gl-link :href="packageLink" class="gl-text-body gl-min-w-0" :disabled="disabledRow">
+          <gl-truncate :text="packageEntity.name" />
+        </gl-link>
+
+        <package-tags
+          v-if="packageEntity.tags.nodes && packageEntity.tags.nodes.length"
+          class="gl-ml-3"
+          :tags="packageEntity.tags.nodes"
+          hide-label
+          :tag-display-limit="1"
+        />
+      </div>
+    </template>
+    <template #left-secondary>
+      {{ packageEntity.version }}
+    </template>
+
+    <template #right-primary>
+      <publish-method :package-entity="packageEntity" />
+    </template>
+
+    <template #right-secondary>
+      <gl-sprintf :message="__('Created %{timestamp}')">
+        <template #timestamp>
+          <time-ago-tooltip :time="packageEntity.createdAt" />
+        </template>
+      </gl-sprintf>
+    </template>
+  </list-item>
+</template>
diff --git a/app/assets/javascripts/packages_and_registries/package_registry/constants.js b/app/assets/javascripts/packages_and_registries/package_registry/constants.js
index c1de9e7a61e..aad888b4433 100644
--- a/app/assets/javascripts/packages_and_registries/package_registry/constants.js
+++ b/app/assets/javascripts/packages_and_registries/package_registry/constants.js
@@ -79,10 +79,10 @@ export const FETCH_PACKAGE_DETAILS_ERROR_MESSAGE = s__(
   'PackageRegistry|Failed to load the package data',
 );
 
-export const PACKAGE_ERROR_STATUS = 'error';
-export const PACKAGE_DEFAULT_STATUS = 'default';
-export const PACKAGE_HIDDEN_STATUS = 'hidden';
-export const PACKAGE_PROCESSING_STATUS = 'processing';
+export const PACKAGE_ERROR_STATUS = 'ERROR';
+export const PACKAGE_DEFAULT_STATUS = 'DEFAULT';
+export const PACKAGE_HIDDEN_STATUS = 'HIDDEN';
+export const PACKAGE_PROCESSING_STATUS = 'PROCESSING';
 
 export const NPM_PACKAGE_MANAGER = 'npm';
 export const YARN_PACKAGE_MANAGER = 'yarn';
diff --git a/app/assets/javascripts/packages_and_registries/package_registry/graphql/queries/get_package_details.query.graphql b/app/assets/javascripts/packages_and_registries/package_registry/graphql/queries/get_package_details.query.graphql
index 6deb406f0db..8fa7649d2d2 100644
--- a/app/assets/javascripts/packages_and_registries/package_registry/graphql/queries/get_package_details.query.graphql
+++ b/app/assets/javascripts/packages_and_registries/package_registry/graphql/queries/get_package_details.query.graphql
@@ -7,7 +7,10 @@ query getPackageDetails($id: ID!) {
     createdAt
     updatedAt
     status
-    tags {
+    project {
+      path
+    }
+    tags(first: 10) {
       nodes {
         id
         name
@@ -42,6 +45,21 @@ query getPackageDetails($id: ID!) {
         downloadPath
       }
     }
+    versions(first: 100) {
+      nodes {
+        id
+        name
+        createdAt
+        version
+        status
+        tags(first: 1) {
+          nodes {
+            id
+            name
+          }
+        }
+      }
+    }
     metadata {
       ... on ComposerMetadata {
         targetSha
diff --git a/app/assets/javascripts/security_configuration/index.js b/app/assets/javascripts/security_configuration/index.js
index a8623b468f2..60d2c0d4e5a 100644
--- a/app/assets/javascripts/security_configuration/index.js
+++ b/app/assets/javascripts/security_configuration/index.js
@@ -14,7 +14,7 @@ export const initSecurityConfiguration = (el) => {
   Vue.use(VueApollo);
 
   const apolloProvider = new VueApollo({
-    defaultClient: createDefaultClient(),
+    defaultClient: createDefaultClient({}, { assumeImmutableResults: true }),
   });
 
   const {
diff --git a/app/assets/stylesheets/page_bundles/boards.scss b/app/assets/stylesheets/page_bundles/boards.scss
index 958cb14935e..10183f774b1 100644
--- a/app/assets/stylesheets/page_bundles/boards.scss
+++ b/app/assets/stylesheets/page_bundles/boards.scss
@@ -153,16 +153,16 @@
 // pseudo-element that is the same size as our element, then
 // animate opacity/transform to give a soothing single pulse
 .board-column-highlighted::after {
+  @include gl-focus;
   content: '';
   position: absolute;
-  top: 0;
-  bottom: 0;
-  left: 0;
-  right: 0;
+  top: -1px;
+  bottom: -1px;
+  left: -1px;
+  right: -1px;
   pointer-events: none;
   opacity: 0;
-  z-index: -1;
-  box-shadow: 0 0 6px 3px $blue-200;
+  border-radius: $border-radius-default;
   animation-name: board-column-flash-border;
   animation-duration: 1.2s;
   animation-fill-mode: forwards;
@@ -173,18 +173,11 @@
   0%,
   100% {
     opacity: 0;
-    transform: scale(0.98);
   }
 
   25%,
   75% {
     opacity: 1;
-    transform: scale(0.99);
-  }
-
-  50% {
-    opacity: 1;
-    transform: scale(1);
   }
 }
 
diff --git a/app/graphql/types/packages/dependency_link_metadata_type.rb b/app/graphql/types/packages/dependency_link_metadata_type.rb
new file mode 100644
index 00000000000..c13069c7889
--- /dev/null
+++ b/app/graphql/types/packages/dependency_link_metadata_type.rb
@@ -0,0 +1,23 @@
+# frozen_string_literal: true
+
+module Types
+  module Packages
+    class DependencyLinkMetadataType < BaseUnion
+      graphql_name 'DependencyLinkMetadata'
+      description 'Represents metadata associated with a dependency link'
+
+      possible_types ::Types::Packages::Nuget::DependencyLinkMetadatumType
+
+      def self.resolve_type(object, context)
+        case object
+        when ::Packages::Nuget::DependencyLinkMetadatum
+          ::Types::Packages::Nuget::DependencyLinkMetadatumType
+        else
+          # NOTE: This method must be kept in sync with `PackageDependencyLinkType#metadata`,
+          # which must never produce data that this discriminator cannot handle.
+          raise 'Unsupported metadata type'
+        end
+      end
+    end
+  end
+end
diff --git a/app/graphql/types/packages/nuget/dependency_link_metadatum_type.rb b/app/graphql/types/packages/nuget/dependency_link_metadatum_type.rb
new file mode 100644
index 00000000000..a717e93b7cb
--- /dev/null
+++ b/app/graphql/types/packages/nuget/dependency_link_metadatum_type.rb
@@ -0,0 +1,17 @@
+# frozen_string_literal: true
+
+module Types
+  module Packages
+    module Nuget
+      class DependencyLinkMetadatumType < BaseObject
+        graphql_name 'NugetDependencyLinkMetadata'
+        description 'Nuget dependency link metadata'
+
+        authorize :read_package
+
+        field :id, ::Types::GlobalIDType[::Packages::Nuget::DependencyLinkMetadatum], null: false, description: 'ID of the metadatum.'
+        field :target_framework, GraphQL::Types::String, null: false, description: 'Target framework of the depdency link package.'
+      end
+    end
+  end
+end
diff --git a/app/graphql/types/packages/package_dependency_link_type.rb b/app/graphql/types/packages/package_dependency_link_type.rb
new file mode 100644
index 00000000000..eceb8319748
--- /dev/null
+++ b/app/graphql/types/packages/package_dependency_link_type.rb
@@ -0,0 +1,40 @@
+# frozen_string_literal: true
+
+module Types
+  module Packages
+    class PackageDependencyLinkType < BaseObject
+      graphql_name 'PackageDependencyLink'
+      description 'Represents a package dependency link'
+      authorize :read_package
+
+      field :id, ::Types::GlobalIDType[::Packages::DependencyLink], null: false, description: 'ID of the dependency link.'
+      field :dependency_type, Types::Packages::PackageDependencyTypeEnum, null: false, description: 'Dependency type.'
+      field :dependency, Types::Packages::PackageDependencyType, null: true, description: 'Dependency.'
+      field :metadata, Types::Packages::DependencyLinkMetadataType, null: true, description: 'Dependency link metadata.'
+
+      # NOTE: This method must be kept in sync with the union
+      # type: `Types::Packages::DependencyLinkMetadata`.
+      #
+      # `Types::Packages::DependencyLinkMetadata.resolve_type(metadata, ctx)` must never raise.
+      def metadata
+        model_class = case object.package.package_type
+                      when 'nuget'
+                        ::Packages::Nuget::DependencyLinkMetadatum
+                      end
+
+        return unless model_class
+
+        # rubocop: disable CodeReuse/ActiveRecord
+        BatchLoader::GraphQL.for(object.id).batch do |ids, loader|
+          results = model_class.where(dependency_link_id: ids)
+          results.each { |record| loader.call(record.dependency_link_id, record) }
+        end
+        # rubocop: enable CodeReuse/ActiveRecord
+      end
+
+      def dependency
+        ::Gitlab::Graphql::Loaders::BatchModelLoader.new(::Packages::Dependency, object.dependency_id).find
+      end
+    end
+  end
+end
diff --git a/app/graphql/types/packages/package_dependency_type.rb b/app/graphql/types/packages/package_dependency_type.rb
new file mode 100644
index 00000000000..dcbc9fa3784
--- /dev/null
+++ b/app/graphql/types/packages/package_dependency_type.rb
@@ -0,0 +1,16 @@
+# frozen_string_literal: true
+# this model does not have any kind of authorization so we disable it
+# rubocop:disable Graphql/AuthorizeTypes
+
+module Types
+  module Packages
+    class PackageDependencyType < BaseObject
+      graphql_name 'PackageDependency'
+      description 'Represents a package dependency.'
+
+      field :id, ::Types::GlobalIDType[::Packages::Dependency], null: false, description: 'ID of the dependency.'
+      field :name, GraphQL::Types::String, null: false, description: 'Name of the dependency.'
+      field :version_pattern, GraphQL::Types::String, null: false, description: 'Version pattern of the dependency.'
+    end
+  end
+end
diff --git a/app/graphql/types/packages/package_dependency_type_enum.rb b/app/graphql/types/packages/package_dependency_type_enum.rb
new file mode 100644
index 00000000000..0e98d149b9a
--- /dev/null
+++ b/app/graphql/types/packages/package_dependency_type_enum.rb
@@ -0,0 +1,13 @@
+# frozen_string_literal: true
+
+module Types
+  module Packages
+    class PackageDependencyTypeEnum < BaseEnum
+      graphql_name 'PackageDependencyType'
+
+      ::Packages::DependencyLink.dependency_types.keys.each do |type|
+        value type.to_s.underscore.upcase, description: "#{type} dependency type", value: type.to_s
+      end
+    end
+  end
+end
diff --git a/app/graphql/types/packages/package_details_type.rb b/app/graphql/types/packages/package_details_type.rb
index 510b7e2ba41..f52b1f02519 100644
--- a/app/graphql/types/packages/package_details_type.rb
+++ b/app/graphql/types/packages/package_details_type.rb
@@ -12,6 +12,8 @@ module Types
 
       field :package_files, Types::Packages::PackageFileType.connection_type, null: true, description: 'Package files.'
 
+      field :dependency_links, Types::Packages::PackageDependencyLinkType.connection_type, null: true, description: 'Dependency link.'
+
       def versions
         object.versions
       end
diff --git a/app/policies/packages/dependency_link_policy.rb b/app/policies/packages/dependency_link_policy.rb
new file mode 100644
index 00000000000..c4425108062
--- /dev/null
+++ b/app/policies/packages/dependency_link_policy.rb
@@ -0,0 +1,6 @@
+# frozen_string_literal: true
+module Packages
+  class DependencyLinkPolicy < BasePolicy
+    delegate { @subject.package }
+  end
+end
diff --git a/app/policies/packages/nuget/dependency_link_metadatum_policy.rb b/app/policies/packages/nuget/dependency_link_metadatum_policy.rb
new file mode 100644
index 00000000000..18bcc1f6585
--- /dev/null
+++ b/app/policies/packages/nuget/dependency_link_metadatum_policy.rb
@@ -0,0 +1,8 @@
+# frozen_string_literal: true
+module Packages
+  module Nuget
+    class DependencyLinkMetadatumPolicy < BasePolicy
+      delegate { @subject.dependency_link.package }
+    end
+  end
+end
diff --git a/config/feature_flags/development/ci_same_stage_job_needs.yml b/config/feature_flags/development/ci_same_stage_job_needs.yml
index a7247320d0d..dfb54edf030 100644
--- a/config/feature_flags/development/ci_same_stage_job_needs.yml
+++ b/config/feature_flags/development/ci_same_stage_job_needs.yml
@@ -5,4 +5,4 @@ rollout_issue_url: https://gitlab.com/gitlab-org/gitlab/-/issues/328253
 milestone: '14.1'
 type: development
 group: group::pipeline authoring
-default_enabled: false
+default_enabled: true
diff --git a/db/migrate/20210809194250_rename_tables_ci_build_trace_section.rb b/db/migrate/20210809194250_rename_tables_ci_build_trace_section.rb
new file mode 100644
index 00000000000..76308e2ea8e
--- /dev/null
+++ b/db/migrate/20210809194250_rename_tables_ci_build_trace_section.rb
@@ -0,0 +1,11 @@
+# frozen_string_literal: true
+
+class RenameTablesCiBuildTraceSection < ActiveRecord::Migration[6.1]
+  DOWNTIME = false
+
+  def change
+    # Shorten deprecated to dep to avoid 'Index name..too long'
+    rename_table(:ci_build_trace_sections, :dep_ci_build_trace_sections)
+    rename_table(:ci_build_trace_section_names, :dep_ci_build_trace_section_names)
+  end
+end
diff --git a/db/schema_migrations/20210809194250 b/db/schema_migrations/20210809194250
new file mode 100644
index 00000000000..c70e543e20e
--- /dev/null
+++ b/db/schema_migrations/20210809194250
@@ -0,0 +1 @@
+35475ad862d713055a90af508dba393834ce8aa60eb1abf46b8f9698c2d42276
\ No newline at end of file
diff --git a/db/structure.sql b/db/structure.sql
index 7fcde03f19e..cffe2d249d0 100644
--- a/db/structure.sql
+++ b/db/structure.sql
@@ -10574,32 +10574,6 @@ CREATE SEQUENCE ci_build_trace_chunks_id_seq
 
 ALTER SEQUENCE ci_build_trace_chunks_id_seq OWNED BY ci_build_trace_chunks.id;
 
-CREATE TABLE ci_build_trace_section_names (
-    id integer NOT NULL,
-    project_id integer NOT NULL,
-    name character varying NOT NULL
-);
-
-CREATE SEQUENCE ci_build_trace_section_names_id_seq
-    START WITH 1
-    INCREMENT BY 1
-    NO MINVALUE
-    NO MAXVALUE
-    CACHE 1;
-
-ALTER SEQUENCE ci_build_trace_section_names_id_seq OWNED BY ci_build_trace_section_names.id;
-
-CREATE TABLE ci_build_trace_sections (
-    project_id integer NOT NULL,
-    date_start timestamp without time zone NOT NULL,
-    date_end timestamp without time zone NOT NULL,
-    byte_start bigint NOT NULL,
-    byte_end bigint NOT NULL,
-    build_id integer NOT NULL,
-    section_name_id integer NOT NULL,
-    build_id_convert_to_bigint bigint DEFAULT 0 NOT NULL
-);
-
 CREATE TABLE ci_builds (
     id integer NOT NULL,
     status character varying,
@@ -12303,6 +12277,33 @@ CREATE SEQUENCE dast_sites_id_seq
 
 ALTER SEQUENCE dast_sites_id_seq OWNED BY dast_sites.id;
 
+CREATE TABLE dep_ci_build_trace_section_names (
+    id integer NOT NULL,
+    project_id integer NOT NULL,
+    name character varying NOT NULL
+);
+
+CREATE SEQUENCE dep_ci_build_trace_section_names_id_seq
+    AS integer
+    START WITH 1
+    INCREMENT BY 1
+    NO MINVALUE
+    NO MAXVALUE
+    CACHE 1;
+
+ALTER SEQUENCE dep_ci_build_trace_section_names_id_seq OWNED BY dep_ci_build_trace_section_names.id;
+
+CREATE TABLE dep_ci_build_trace_sections (
+    project_id integer NOT NULL,
+    date_start timestamp without time zone NOT NULL,
+    date_end timestamp without time zone NOT NULL,
+    byte_start bigint NOT NULL,
+    byte_end bigint NOT NULL,
+    build_id integer NOT NULL,
+    section_name_id integer NOT NULL,
+    build_id_convert_to_bigint bigint DEFAULT 0 NOT NULL
+);
+
 CREATE TABLE dependency_proxy_blobs (
     id integer NOT NULL,
     group_id integer NOT NULL,
@@ -20087,8 +20088,6 @@ ALTER TABLE ONLY ci_build_report_results ALTER COLUMN build_id SET DEFAULT nextv
 
 ALTER TABLE ONLY ci_build_trace_chunks ALTER COLUMN id SET DEFAULT nextval('ci_build_trace_chunks_id_seq'::regclass);
 
-ALTER TABLE ONLY ci_build_trace_section_names ALTER COLUMN id SET DEFAULT nextval('ci_build_trace_section_names_id_seq'::regclass);
-
 ALTER TABLE ONLY ci_builds ALTER COLUMN id SET DEFAULT nextval('ci_builds_id_seq'::regclass);
 
 ALTER TABLE ONLY ci_builds_metadata ALTER COLUMN id SET DEFAULT nextval('ci_builds_metadata_id_seq'::regclass);
@@ -20237,6 +20236,8 @@ ALTER TABLE ONLY dast_site_validations ALTER COLUMN id SET DEFAULT nextval('dast
 
 ALTER TABLE ONLY dast_sites ALTER COLUMN id SET DEFAULT nextval('dast_sites_id_seq'::regclass);
 
+ALTER TABLE ONLY dep_ci_build_trace_section_names ALTER COLUMN id SET DEFAULT nextval('dep_ci_build_trace_section_names_id_seq'::regclass);
+
 ALTER TABLE ONLY dependency_proxy_blobs ALTER COLUMN id SET DEFAULT nextval('dependency_proxy_blobs_id_seq'::regclass);
 
 ALTER TABLE ONLY dependency_proxy_group_settings ALTER COLUMN id SET DEFAULT nextval('dependency_proxy_group_settings_id_seq'::regclass);
@@ -21292,10 +21293,7 @@ ALTER TABLE ONLY ci_build_report_results
 ALTER TABLE ONLY ci_build_trace_chunks
     ADD CONSTRAINT ci_build_trace_chunks_pkey PRIMARY KEY (id);
 
-ALTER TABLE ONLY ci_build_trace_section_names
-    ADD CONSTRAINT ci_build_trace_section_names_pkey PRIMARY KEY (id);
-
-ALTER TABLE ONLY ci_build_trace_sections
+ALTER TABLE ONLY dep_ci_build_trace_sections
     ADD CONSTRAINT ci_build_trace_sections_pkey PRIMARY KEY (build_id, section_name_id);
 
 ALTER TABLE ONLY ci_builds_metadata
@@ -21541,6 +21539,9 @@ ALTER TABLE ONLY dast_site_validations
 ALTER TABLE ONLY dast_sites
     ADD CONSTRAINT dast_sites_pkey PRIMARY KEY (id);
 
+ALTER TABLE ONLY dep_ci_build_trace_section_names
+    ADD CONSTRAINT dep_ci_build_trace_section_names_pkey PRIMARY KEY (id);
+
 ALTER TABLE ONLY dependency_proxy_blobs
     ADD CONSTRAINT dependency_proxy_blobs_pkey PRIMARY KEY (id);
 
@@ -23241,12 +23242,6 @@ CREATE INDEX index_ci_build_report_results_on_project_id ON ci_build_report_resu
 
 CREATE UNIQUE INDEX index_ci_build_trace_chunks_on_build_id_and_chunk_index ON ci_build_trace_chunks USING btree (build_id, chunk_index);
 
-CREATE UNIQUE INDEX index_ci_build_trace_section_names_on_project_id_and_name ON ci_build_trace_section_names USING btree (project_id, name);
-
-CREATE INDEX index_ci_build_trace_sections_on_project_id ON ci_build_trace_sections USING btree (project_id);
-
-CREATE INDEX index_ci_build_trace_sections_on_section_name_id ON ci_build_trace_sections USING btree (section_name_id);
-
 CREATE UNIQUE INDEX index_ci_builds_metadata_on_build_id ON ci_builds_metadata USING btree (build_id);
 
 CREATE INDEX index_ci_builds_metadata_on_build_id_and_has_exposed_artifacts ON ci_builds_metadata USING btree (build_id) WHERE (has_exposed_artifacts IS TRUE);
@@ -23647,6 +23642,12 @@ CREATE INDEX index_dast_sites_on_dast_site_validation_id ON dast_sites USING btr
 
 CREATE UNIQUE INDEX index_dast_sites_on_project_id_and_url ON dast_sites USING btree (project_id, url);
 
+CREATE UNIQUE INDEX index_dep_ci_build_trace_section_names_on_project_id_and_name ON dep_ci_build_trace_section_names USING btree (project_id, name);
+
+CREATE INDEX index_dep_ci_build_trace_sections_on_project_id ON dep_ci_build_trace_sections USING btree (project_id);
+
+CREATE INDEX index_dep_ci_build_trace_sections_on_section_name_id ON dep_ci_build_trace_sections USING btree (section_name_id);
+
 CREATE INDEX index_dependency_proxy_blobs_on_group_id_and_file_name ON dependency_proxy_blobs USING btree (group_id, file_name);
 
 CREATE INDEX index_dependency_proxy_group_settings_on_group_id ON dependency_proxy_group_settings USING btree (group_id);
@@ -25989,7 +25990,7 @@ CREATE TRIGGER trigger_8485e97c00e3 BEFORE INSERT OR UPDATE ON ci_sources_pipeli
 
 CREATE TRIGGER trigger_8487d4de3e7b BEFORE INSERT OR UPDATE ON ci_builds_metadata FOR EACH ROW EXECUTE FUNCTION trigger_8487d4de3e7b();
 
-CREATE TRIGGER trigger_91dc388a5fe6 BEFORE INSERT OR UPDATE ON ci_build_trace_sections FOR EACH ROW EXECUTE FUNCTION trigger_91dc388a5fe6();
+CREATE TRIGGER trigger_91dc388a5fe6 BEFORE INSERT OR UPDATE ON dep_ci_build_trace_sections FOR EACH ROW EXECUTE FUNCTION trigger_91dc388a5fe6();
 
 CREATE TRIGGER trigger_aebe8b822ad3 BEFORE INSERT OR UPDATE ON taggings FOR EACH ROW EXECUTE FUNCTION trigger_aebe8b822ad3();
 
@@ -26133,8 +26134,8 @@ ALTER TABLE ONLY projects
 ALTER TABLE ONLY ci_pipelines
     ADD CONSTRAINT fk_262d4c2d19 FOREIGN KEY (auto_canceled_by_id) REFERENCES ci_pipelines(id) ON DELETE SET NULL;
 
-ALTER TABLE ONLY ci_build_trace_sections
-    ADD CONSTRAINT fk_264e112c66 FOREIGN KEY (section_name_id) REFERENCES ci_build_trace_section_names(id) ON DELETE CASCADE;
+ALTER TABLE ONLY dep_ci_build_trace_sections
+    ADD CONSTRAINT fk_264e112c66 FOREIGN KEY (section_name_id) REFERENCES dep_ci_build_trace_section_names(id) ON DELETE CASCADE;
 
 ALTER TABLE ONLY geo_event_log
     ADD CONSTRAINT fk_27548c6db3 FOREIGN KEY (hashed_storage_migrated_event_id) REFERENCES geo_hashed_storage_migrated_events(id) ON DELETE CASCADE;
@@ -26220,7 +26221,7 @@ ALTER TABLE ONLY releases
 ALTER TABLE ONLY geo_event_log
     ADD CONSTRAINT fk_4a99ebfd60 FOREIGN KEY (repositories_changed_event_id) REFERENCES geo_repositories_changed_events(id) ON DELETE CASCADE;
 
-ALTER TABLE ONLY ci_build_trace_sections
+ALTER TABLE ONLY dep_ci_build_trace_sections
     ADD CONSTRAINT fk_4ebe41f502 FOREIGN KEY (build_id) REFERENCES ci_builds(id) ON DELETE CASCADE;
 
 ALTER TABLE ONLY alert_management_alerts
@@ -26517,6 +26518,9 @@ ALTER TABLE ONLY alert_management_alerts
 ALTER TABLE ONLY identities
     ADD CONSTRAINT fk_aade90f0fc FOREIGN KEY (saml_provider_id) REFERENCES saml_providers(id) ON DELETE CASCADE;
 
+ALTER TABLE ONLY dep_ci_build_trace_sections
+    ADD CONSTRAINT fk_ab7c104e26 FOREIGN KEY (project_id) REFERENCES projects(id) ON DELETE CASCADE;
+
 ALTER TABLE ONLY ci_sources_pipelines
     ADD CONSTRAINT fk_acd9737679 FOREIGN KEY (source_project_id) REFERENCES projects(id) ON DELETE CASCADE;
 
@@ -26787,6 +26791,9 @@ ALTER TABLE ONLY cluster_agents
 ALTER TABLE ONLY protected_tag_create_access_levels
     ADD CONSTRAINT fk_f7dfda8c51 FOREIGN KEY (protected_tag_id) REFERENCES protected_tags(id) ON DELETE CASCADE;
 
+ALTER TABLE ONLY dep_ci_build_trace_section_names
+    ADD CONSTRAINT fk_f8cd72cd26 FOREIGN KEY (project_id) REFERENCES projects(id) ON DELETE CASCADE;
+
 ALTER TABLE ONLY ci_stages
     ADD CONSTRAINT fk_fb57e6cc56 FOREIGN KEY (pipeline_id) REFERENCES ci_pipelines(id) ON DELETE CASCADE;
 
@@ -27903,9 +27910,6 @@ ALTER TABLE ONLY merge_request_user_mentions
 ALTER TABLE ONLY x509_commit_signatures
     ADD CONSTRAINT fk_rails_ab07452314 FOREIGN KEY (project_id) REFERENCES projects(id) ON DELETE CASCADE;
 
-ALTER TABLE ONLY ci_build_trace_sections
-    ADD CONSTRAINT fk_rails_ab7c104e26 FOREIGN KEY (project_id) REFERENCES projects(id) ON DELETE CASCADE;
-
 ALTER TABLE ONLY resource_iteration_events
     ADD CONSTRAINT fk_rails_abf5d4affa FOREIGN KEY (issue_id) REFERENCES issues(id) ON DELETE CASCADE;
 
@@ -28365,9 +28369,6 @@ ALTER TABLE ONLY issues_self_managed_prometheus_alert_events
 ALTER TABLE ONLY merge_requests_closing_issues
     ADD CONSTRAINT fk_rails_f8540692be FOREIGN KEY (issue_id) REFERENCES issues(id) ON DELETE CASCADE;
 
-ALTER TABLE ONLY ci_build_trace_section_names
-    ADD CONSTRAINT fk_rails_f8cd72cd26 FOREIGN KEY (project_id) REFERENCES projects(id) ON DELETE CASCADE;
-
 ALTER TABLE ONLY merge_trains
     ADD CONSTRAINT fk_rails_f90820cb08 FOREIGN KEY (pipeline_id) REFERENCES ci_pipelines(id) ON DELETE SET NULL;
 
diff --git a/doc/administration/geo/replication/datatypes.md b/doc/administration/geo/replication/datatypes.md
index dd1c7730791..62b366e9a4a 100644
--- a/doc/administration/geo/replication/datatypes.md
+++ b/doc/administration/geo/replication/datatypes.md
@@ -200,7 +200,7 @@ successfully, you must replicate their data using some other means.
 |[Package Registry for generic packages](../../../user/packages/generic_packages/index.md)                      | **Yes** (13.5)                                                          | [**Yes**](#limitation-of-verification-for-files-in-object-storage) (13.10)                                                         | Via Object Storage provider if supported. Native Geo support (Beta).          | Behind feature flag `geo_package_file_replication`, enabled by default. |
 |[Versioned Terraform State](../../terraform_state.md)                                                          | **Yes** (13.5)                                                          | [**Yes**](#limitation-of-verification-for-files-in-object-storage) (13.12)                                                                     | Via Object Storage provider if supported. Native Geo support (Beta).          | Replication is behind the feature flag `geo_terraform_state_version_replication`, enabled by default. Verification was behind the feature flag `geo_terraform_state_version_verification`, which was removed in 14.0|
 |[External merge request diffs](../../merge_request_diffs.md)                                                   | **Yes** (13.5)                                                          | No                                                                      | Via Object Storage provider if supported. Native Geo support (Beta).          | Replication is behind the feature flag `geo_merge_request_diff_replication`, enabled by default. Verification is under development, behind the feature flag `geo_merge_request_diff_verification`, introduced in 14.0.|
-|[Versioned snippets](../../../user/snippets.md#versioned-snippets)                                             | [**Yes** (13.7)](https://gitlab.com/groups/gitlab-org/-/epics/2809)     | [**Yes**](https://gitlab.com/groups/gitlab-org/-/epics/2810)            | No                                                                            | Verification was implemented behind the feature flag `geo_snippet_repository_verification` in 13.11, and the feature flag was removed in 14.2. |
+|[Versioned snippets](../../../user/snippets.md#versioned-snippets)                                             | [**Yes** (13.7)](https://gitlab.com/groups/gitlab-org/-/epics/2809)     | [**Yes** (14.2)](https://gitlab.com/groups/gitlab-org/-/epics/2810)            | No                                                                            | Verification was implemented behind the feature flag `geo_snippet_repository_verification` in 13.11, and the feature flag was removed in 14.2. |
 |[Server-side Git hooks](../../server_hooks.md)                                                                 | [No](https://gitlab.com/groups/gitlab-org/-/epics/1867)                 | No                                                                      | No                                                                            |       |
 |[Elasticsearch integration](../../../integration/elasticsearch.md)                                             | [No](https://gitlab.com/gitlab-org/gitlab/-/issues/1186)                | No                                                                      | No                                                                            |       |
 |[GitLab Pages](../../pages/index.md)                                                                           | [No](https://gitlab.com/groups/gitlab-org/-/epics/589)                  | No                                                                      | Via Object Storage provider if supported. **No** native Geo support (Beta).                                                                            |       |
diff --git a/doc/administration/lfs/index.md b/doc/administration/lfs/index.md
index edf0e324a5c..682352d8f59 100644
--- a/doc/administration/lfs/index.md
+++ b/doc/administration/lfs/index.md
@@ -323,7 +323,7 @@ See more information in [!19581](https://gitlab.com/gitlab-org/gitlab-foss/-/mer
 
 ### LFS commands fail on TLS v1.3 server
 
-If you configure GitLab to [disable TLS v1.2](https://docs.gitlab.com/omnibus/settings/nginx.md)
+If you configure GitLab to [disable TLS v1.2](https://docs.gitlab.com/omnibus/settings/nginx.html)
 and only enable TLS v1.3 connections, LFS operations require a
 [Git LFS client](https://git-lfs.github.com) version 2.11.0 or later. If you use
 a Git LFS client earlier than version 2.11.0, GitLab displays an error:
@@ -334,7 +334,7 @@ error: failed to fetch some objects from 'https://username:[MASKED]@gitlab.examp
 ```
 
 When using GitLab CI over a TLS v1.3 configured GitLab server, you must
-[upgrade to GitLab Runner](https://docs.gitlab.com/runner/install/index.md) 13.2.0
+[upgrade to GitLab Runner](https://docs.gitlab.com/runner/install/index.html) 13.2.0
 or later to receive an updated Git LFS client version via
 the included [GitLab Runner Helper image](https://docs.gitlab.com/runner/configuration/advanced-configuration.html#helper-image).
 
diff --git a/doc/administration/postgresql/replication_and_failover.md b/doc/administration/postgresql/replication_and_failover.md
index d37d61048e2..b6f028e1326 100644
--- a/doc/administration/postgresql/replication_and_failover.md
+++ b/doc/administration/postgresql/replication_and_failover.md
@@ -303,6 +303,63 @@ If you enable Monitoring, it must be enabled on **all** database servers.
 
 1. Run `sudo gitlab-ctl reconfigure` to compile the configuration.
 
+#### Enable TLS support for the Patroni API
+
+By default, Patroni's [REST API](https://patroni.readthedocs.io/en/latest/rest_api.html#rest-api) is served over HTTP.
+You have the option to enable TLS and use HTTPS over the same [port](https://docs.gitlab.com/omnibus/package-information/defaults.html#patroni).
+
+To enable TLS, you need PEM-formatted certificate and private key files. Both files must be readable by the PostgreSQL user (`gitlab-psql` by default, or the one set by `postgresql['username']`):
+
+```ruby
+patroni['tls_certificate_file'] = '/path/to/server/certificate.pem'
+patroni['tls_key_file'] = '/path/to/server/key.pem'
+```
+
+If the server's private key is encrypted, specify the password to decrypt it:
+
+```ruby
+patroni['tls_key_password'] = 'private-key-password' # This is the plain-text password.
+```
+
+If you are using a self-signed certificate or an internal CA, you need to either disable the TLS verification or pass the certificate of the
+internal CA, otherwise you may run into an unexpected error when using the `gitlab-ctl patroni ....` commands. Omnibus ensures that Patroni API
+clients honor this configuration.
+
+TLS certificate verification is enabled by default. To disable it:
+
+```ruby
+patroni['tls_verify'] = false
+```
+
+Alternatively, you can pass a PEM-formatted certificate of the internal CA. Again, the file must be readable by the PostgreSQL user:
+
+```ruby
+patroni['tls_ca_file'] = '/path/to/ca.pem'
+```
+
+When TLS is enabled, mutual authentication of the API server and client is possible for all endpoints, the extent of which depends on
+the `patroni['tls_client_mode']` attribute:
+
+- `none` (default): the API will not check for any client certificates.
+- `optional`: client certificates are required for all [unsafe](https://patroni.readthedocs.io/en/latest/security.html#protecting-the-rest-api) API calls.
+- `required`: client certificates are required for all API calls.
+
+The client certificates are verified against the CA certificate that is specified with the `patroni['tls_ca_file']` attribute. Therefore,
+this attribute is required for mutual TLS authentication. You also need to specify PEM-formatted client certificate and private key files.
+Both files must be readable by the PostgreSQL user:
+
+```ruby
+patroni['tls_client_mode'] = 'required'
+patroni['tls_ca_file'] = '/path/to/ca.pem'
+
+patroni['tls_client_certificate_file'] = '/path/to/client/certificate.pem'
+patroni['tls_client_key_file'] = '/path/to/client/key.pem'
+```
+
+You can use different certificates and keys for both API server and client on different Patroni nodes as long as they can be verified.
+However, the CA certificate (`patroni['tls_ca_file']`), TLS certificate verification (`patroni['tls_verify']`), and client TLS
+authentication mode (`patroni['tls_client_mode']`), must each have the same value on all nodes.
+
 ### Configuring the PgBouncer node
 
 1. Make sure you collect [`CONSUL_SERVER_NODES`](#consul-information), [`CONSUL_PASSWORD_HASH`](#consul-information), and [`PGBOUNCER_PASSWORD_HASH`](#pgbouncer-information) before executing the next step.
diff --git a/doc/administration/troubleshooting/debug.md b/doc/administration/troubleshooting/debug.md
index 9ec6bd1a9cb..aea891b8a77 100644
--- a/doc/administration/troubleshooting/debug.md
+++ b/doc/administration/troubleshooting/debug.md
@@ -285,5 +285,5 @@ The output in `/tmp/puma.txt` may help diagnose the root cause.
 
 ## More information
 
-- [Debugging Stuck Ruby Processes](https://newrelic.com/blog/engineering/debugging-stuck-ruby-processes-what-to-do-before-you-kill-9/)
+- [Debugging Stuck Ruby Processes](https://newrelic.com/blog/best-practices/debugging-stuck-ruby-processes-what-to-do-before-you-kill-9)
 - [Cheat sheet of using GDB and Ruby processes](gdb-stuck-ruby.txt)
diff --git a/doc/api/graphql/reference/index.md b/doc/api/graphql/reference/index.md
index 562c119042c..64b85b60ed4 100644
--- a/doc/api/graphql/reference/index.md
+++ b/doc/api/graphql/reference/index.md
@@ -6237,6 +6237,29 @@ The connection type for [`Package`](#package).
 | <a id="packageconnectionnodes"></a>`nodes` | [`[Package]`](#package) | A list of nodes. |
 | <a id="packageconnectionpageinfo"></a>`pageInfo` | [`PageInfo!`](#pageinfo) | Information to aid in pagination. |
 
+#### `PackageDependencyLinkConnection`
+
+The connection type for [`PackageDependencyLink`](#packagedependencylink).
+
+##### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="packagedependencylinkconnectionedges"></a>`edges` | [`[PackageDependencyLinkEdge]`](#packagedependencylinkedge) | A list of edges. |
+| <a id="packagedependencylinkconnectionnodes"></a>`nodes` | [`[PackageDependencyLink]`](#packagedependencylink) | A list of nodes. |
+| <a id="packagedependencylinkconnectionpageinfo"></a>`pageInfo` | [`PageInfo!`](#pageinfo) | Information to aid in pagination. |
+
+#### `PackageDependencyLinkEdge`
+
+The edge type for [`PackageDependencyLink`](#packagedependencylink).
+
+##### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="packagedependencylinkedgecursor"></a>`cursor` | [`String!`](#string) | A cursor for use in pagination. |
+| <a id="packagedependencylinkedgenode"></a>`node` | [`PackageDependencyLink`](#packagedependencylink) | The item at the end of the edge. |
+
 #### `PackageEdge`
 
 The edge type for [`Package`](#package).
@@ -11330,6 +11353,17 @@ Represents the network policy.
 | <a id="notepermissionsrepositionnote"></a>`repositionNote` | [`Boolean!`](#boolean) | Indicates the user can perform `reposition_note` on this resource. |
 | <a id="notepermissionsresolvenote"></a>`resolveNote` | [`Boolean!`](#boolean) | Indicates the user can perform `resolve_note` on this resource. |
 
+### `NugetDependencyLinkMetadata`
+
+Nuget dependency link metadata.
+
+#### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="nugetdependencylinkmetadataid"></a>`id` | [`PackagesNugetDependencyLinkMetadatumID!`](#packagesnugetdependencylinkmetadatumid) | ID of the metadatum. |
+| <a id="nugetdependencylinkmetadatatargetframework"></a>`targetFramework` | [`String!`](#string) | Target framework of the depdency link package. |
+
 ### `NugetMetadata`
 
 Nuget metadata.
@@ -11401,6 +11435,31 @@ Represents a composer JSON file.
 | <a id="packagecomposerjsontypetype"></a>`type` | [`String`](#string) | The type set in the Composer JSON file. |
 | <a id="packagecomposerjsontypeversion"></a>`version` | [`String`](#string) | The version set in the Composer JSON file. |
 
+### `PackageDependency`
+
+Represents a package dependency.
+
+#### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="packagedependencyid"></a>`id` | [`PackagesDependencyID!`](#packagesdependencyid) | ID of the dependency. |
+| <a id="packagedependencyname"></a>`name` | [`String!`](#string) | Name of the dependency. |
+| <a id="packagedependencyversionpattern"></a>`versionPattern` | [`String!`](#string) | Version pattern of the dependency. |
+
+### `PackageDependencyLink`
+
+Represents a package dependency link.
+
+#### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="packagedependencylinkdependency"></a>`dependency` | [`PackageDependency`](#packagedependency) | Dependency. |
+| <a id="packagedependencylinkdependencytype"></a>`dependencyType` | [`PackageDependencyType!`](#packagedependencytype) | Dependency type. |
+| <a id="packagedependencylinkid"></a>`id` | [`PackagesDependencyLinkID!`](#packagesdependencylinkid) | ID of the dependency link. |
+| <a id="packagedependencylinkmetadata"></a>`metadata` | [`DependencyLinkMetadata`](#dependencylinkmetadata) | Dependency link metadata. |
+
 ### `PackageDetailsType`
 
 Represents a package details in the Package Registry. Note that this type is in beta and susceptible to changes.
@@ -11410,6 +11469,7 @@ Represents a package details in the Package Registry. Note that this type is in
 | Name | Type | Description |
 | ---- | ---- | ----------- |
 | <a id="packagedetailstypecreatedat"></a>`createdAt` | [`Time!`](#time) | Date of creation. |
+| <a id="packagedetailstypedependencylinks"></a>`dependencyLinks` | [`PackageDependencyLinkConnection`](#packagedependencylinkconnection) | Dependency link. (see [Connections](#connections)) |
 | <a id="packagedetailstypeid"></a>`id` | [`PackagesPackageID!`](#packagespackageid) | ID of the package. |
 | <a id="packagedetailstypemetadata"></a>`metadata` | [`PackageMetadata`](#packagemetadata) | Package metadata. |
 | <a id="packagedetailstypename"></a>`name` | [`String!`](#string) | Name of the package. |
@@ -15330,6 +15390,15 @@ Rotation length unit of an on-call rotation.
 | <a id="oncallrotationunitenumhours"></a>`HOURS` | Hours. |
 | <a id="oncallrotationunitenumweeks"></a>`WEEKS` | Weeks. |
 
+### `PackageDependencyType`
+
+| Value | Description |
+| ----- | ----------- |
+| <a id="packagedependencytypebundle_dependencies"></a>`BUNDLE_DEPENDENCIES` | bundleDependencies dependency type. |
+| <a id="packagedependencytypedependencies"></a>`DEPENDENCIES` | dependencies dependency type. |
+| <a id="packagedependencytypedev_dependencies"></a>`DEV_DEPENDENCIES` | devDependencies dependency type. |
+| <a id="packagedependencytypepeer_dependencies"></a>`PEER_DEPENDENCIES` | peerDependencies dependency type. |
+
 ### `PackageGroupSort`
 
 Values for sorting group packages.
@@ -16204,12 +16273,30 @@ A `PackagesConanMetadatumID` is a global ID. It is encoded as a string.
 
 An example `PackagesConanMetadatumID` is: `"gid://gitlab/Packages::Conan::Metadatum/1"`.
 
+### `PackagesDependencyID`
+
+A `PackagesDependencyID` is a global ID. It is encoded as a string.
+
+An example `PackagesDependencyID` is: `"gid://gitlab/Packages::Dependency/1"`.
+
+### `PackagesDependencyLinkID`
+
+A `PackagesDependencyLinkID` is a global ID. It is encoded as a string.
+
+An example `PackagesDependencyLinkID` is: `"gid://gitlab/Packages::DependencyLink/1"`.
+
 ### `PackagesMavenMetadatumID`
 
 A `PackagesMavenMetadatumID` is a global ID. It is encoded as a string.
 
 An example `PackagesMavenMetadatumID` is: `"gid://gitlab/Packages::Maven::Metadatum/1"`.
 
+### `PackagesNugetDependencyLinkMetadatumID`
+
+A `PackagesNugetDependencyLinkMetadatumID` is a global ID. It is encoded as a string.
+
+An example `PackagesNugetDependencyLinkMetadatumID` is: `"gid://gitlab/Packages::Nuget::DependencyLinkMetadatum/1"`.
+
 ### `PackagesNugetMetadatumID`
 
 A `PackagesNugetMetadatumID` is a global ID. It is encoded as a string.
@@ -16339,6 +16426,14 @@ abstract types.
 
 ### Unions
 
+#### `DependencyLinkMetadata`
+
+Represents metadata associated with a dependency link.
+
+One of:
+
+- [`NugetDependencyLinkMetadata`](#nugetdependencylinkmetadata)
+
 #### `Issuable`
 
 Represents an issuable.
diff --git a/doc/ci/examples/deployment/index.md b/doc/ci/examples/deployment/index.md
index 05ba704eb1a..14fb77dc49f 100644
--- a/doc/ci/examples/deployment/index.md
+++ b/doc/ci/examples/deployment/index.md
@@ -115,11 +115,15 @@ We also use two secure variables:
 
 ## Storing API keys
 
-To add secure variables, navigate to your project's
-**Settings > CI/CD > Variables**. The variables defined
-in the project settings are sent along with the build script to the runner.
+To store API keys as secure variables:
+
+1. On the top bar, select **Menu > Projects** and find your project.
+1. On the left sidebar, select **Settings > CI/CD**.
+1. Expand **Variables**.
+
+The variables defined in the project settings are sent along with the build script to the runner.
 The secure variables are stored out of the repository. Never store secrets in
-your project's `.gitlab-ci.yml`. It is also important that the secret's value
+your project's `.gitlab-ci.yml` file. It is also important that the secret's value
 is hidden in the job log.
 
 You access added variable by prefixing it's name with `$` (on non-Windows runners)
@@ -128,4 +132,4 @@ or `%` (for Windows Batch runners):
 - `$VARIABLE`: Use for non-Windows runners
 - `%VARIABLE%`: Use for Windows Batch runners
 
-Read more about the [CI/CD variables](../../variables/index.md).
+Read more about [CI/CD variables](../../variables/index.md).
diff --git a/doc/ci/yaml/index.md b/doc/ci/yaml/index.md
index 99b9d2359d0..901fdc38234 100644
--- a/doc/ci/yaml/index.md
+++ b/doc/ci/yaml/index.md
@@ -1471,6 +1471,7 @@ in the project.
 > - [Introduced](https://gitlab.com/gitlab-org/gitlab-foss/-/issues/47063) in GitLab 12.2.
 > - In GitLab 12.3, maximum number of jobs in `needs` array raised from five to 50.
 > - [Introduced](https://gitlab.com/gitlab-org/gitlab/-/issues/30631) in GitLab 12.8, `needs: []` lets jobs start immediately.
+> - [Introduced](https://gitlab.com/gitlab-org/gitlab/-/issues/30632) in GitLab 14.2, you can refer to jobs in the same stage as the job you are configuring.
 
 Use `needs:` to execute jobs out-of-order. Relationships between jobs
 that use `needs` can be visualized as a [directed acyclic graph](../directed_acyclic_graph/index.md).
@@ -1531,15 +1532,10 @@ production:
 #### Requirements and limitations
 
 - In [GitLab 14.1 and later](https://gitlab.com/gitlab-org/gitlab/-/issues/30632) you
-  can refer to jobs in the same stage as the job you are configuring. This feature is:
-
-  - [Deployed behind a feature flag](../../user/feature_flags.md), disabled by default.
-  - Disabled on GitLab.com.
-  - Not recommended for production use.
-  
-  For GitLab self-managed instances, GitLab administrators can choose to
-  [enable it](#enable-or-disable-needs-for-jobs-in-the-same-stage).
-
+  can refer to jobs in the same stage as the job you are configuring. This feature is
+  enabled on GitLab.com and ready for production use. On self-managed [GitLab 14.2 and later](https://gitlab.com/gitlab-org/gitlab/-/issues/30632)
+  this feature is available by default. To hide the feature, ask an administrator to
+  [disable the `ci_same_stage_job_needs` flag](../../administration/feature_flags.md).
 - In GitLab 14.0 and older, you can only refer to jobs in earlier stages.
 - In GitLab 13.9 and older, if `needs:` refers to a job that might not be added to
   a pipeline because of `only`, `except`, or `rules`, the pipeline might fail to create.
@@ -1557,22 +1553,6 @@ production:
 - Stages must be explicitly defined for all jobs
   that have the keyword `needs:` or are referred to by one.
 
-##### Enable or disable `needs` for jobs in the same stage **(FREE SELF)**
-
-`needs` for jobs in the same stage is under development but ready for production use.
-It is deployed behind a feature flag that is **enabled by default**.
-[GitLab administrators with access to the GitLab Rails
-console](../../administration/feature_flags.md)
-can opt to disable it.
-
-To enable it:
-
-`Feature.enable(:ci_same_stage_job_needs)`
-
-To disable it:
-
-`Feature.disable(:ci_same_stage_job_needs)`
-
 ##### Changing the `needs:` job limit **(FREE SELF)**
 
 The maximum number of jobs that can be defined in `needs:` defaults to 50.
diff --git a/doc/development/documentation/styleguide/word_list.md b/doc/development/documentation/styleguide/word_list.md
index 8ff3b2cd29d..72c3d605388 100644
--- a/doc/development/documentation/styleguide/word_list.md
+++ b/doc/development/documentation/styleguide/word_list.md
@@ -122,7 +122,7 @@ Title case.
 
 ## GitLab
 
-Do not make possessive (GitLab's). This guidance follows [GitLab Brand Guidelines](https://about.gitlab.com/handbook/marketing/corporate-marketing/brand-activation/brand-guidelines/#trademark).
+Do not make possessive (GitLab's). This guidance follows [GitLab Trademark Guidelines](https://about.gitlab.com/handbook/marketing/corporate-marketing/brand-activation/trademark-guidelines/).
 
 ## GitLab.com
 
diff --git a/doc/development/testing_guide/end_to_end/best_practices.md b/doc/development/testing_guide/end_to_end/best_practices.md
index 15520d8a6b1..74c02d19d0a 100644
--- a/doc/development/testing_guide/end_to_end/best_practices.md
+++ b/doc/development/testing_guide/end_to_end/best_practices.md
@@ -338,6 +338,16 @@ Page::Project::Pipeline::Show.perform do |pipeline|
 end
 ```
 
+### Use `eventually_` matchers for expectations that require waiting
+
+When something requires waiting to be matched, use `eventually_` matchers with clear wait duration definition.
+
+`Eventually` matchers use the following naming pattern: `eventually_${rspec_matcher_name}`. They are defined in [eventually_matcher.rb](https://gitlab.com/gitlab-org/gitlab/-/blob/master/qa/spec/support/matchers/eventually_matcher.rb).
+
+```ruby
+expect { async_value }.to eventually_eq(value).within(max_duration: 120, max_attempts: 60, reload_page: page)
+```
+
 ### Create negatable matchers to speed `expect` checks
 
 However, sometimes we want to check that something is _not_ as we _don't_ want it to be. In other
diff --git a/doc/user/project/merge_requests/changes.md b/doc/user/project/merge_requests/changes.md
index 9a0f5fa4226..c59d5973e21 100644
--- a/doc/user/project/merge_requests/changes.md
+++ b/doc/user/project/merge_requests/changes.md
@@ -85,11 +85,15 @@ entire content by selecting **Show file contents**.
 
 ## Ignore whitespace changes in Merge Request diff view
 
-If you select the **Hide whitespace changes** button, you can see the diff
-without whitespace changes (if there are any). This is also working when on a
-specific commit page.
+Whitespace changes can make it more difficult to see the substantive changes in
+a merge request. You can choose to hide or show whitespace changes:
 
-![MR diff](img/merge_request_diff.png)
+1. Go to your merge request, and select the **Changes** tab.
+1. Above the list of changed files, select **(settings)** **Preferences** to
+   display the preferences menu.
+1. Select or deselect **Show whitespace changes**:
+
+   ![MR diff](img/merge_request_diff_v14_2.png)
 
 ## Mark files as viewed
 
diff --git a/doc/user/project/merge_requests/img/merge_request_diff.png b/doc/user/project/merge_requests/img/merge_request_diff.png
deleted file mode 100644
index 9c5488cb207..00000000000
Binary files a/doc/user/project/merge_requests/img/merge_request_diff.png and /dev/null differ
diff --git a/doc/user/project/merge_requests/img/merge_request_diff_v14_2.png b/doc/user/project/merge_requests/img/merge_request_diff_v14_2.png
new file mode 100644
index 00000000000..de534f17bf1
Binary files /dev/null and b/doc/user/project/merge_requests/img/merge_request_diff_v14_2.png differ
diff --git a/lib/gitlab/ci/config/entry/job.rb b/lib/gitlab/ci/config/entry/job.rb
index e6d63969161..bd4d5f33689 100644
--- a/lib/gitlab/ci/config/entry/job.rb
+++ b/lib/gitlab/ci/config/entry/job.rb
@@ -16,11 +16,8 @@ module Gitlab
                             environment coverage retry parallel interruptible timeout
                             release dast_configuration secrets].freeze
 
-          REQUIRED_BY_NEEDS = %i[stage].freeze
-
           validations do
             validates :config, allowed_keys: ALLOWED_KEYS + PROCESSABLE_ALLOWED_KEYS
-            validates :config, required_keys: REQUIRED_BY_NEEDS, if: :has_needs?
             validates :script, presence: true
 
             with_options allow_nil: true do
diff --git a/locale/gitlab.pot b/locale/gitlab.pot
index f3ffeb2b819..f3b3b2130e0 100644
--- a/locale/gitlab.pot
+++ b/locale/gitlab.pot
@@ -9198,7 +9198,7 @@ msgstr ""
 msgid "CorpusManagement|Latest Job:"
 msgstr ""
 
-msgid "CorpusManagement|New corpus needs to be a upload in *.zip format. Maximum 10Gib"
+msgid "CorpusManagement|New corpus needs to be a upload in *.zip format. Maximum 10GB"
 msgstr ""
 
 msgid "CorpusManagement|New upload"
@@ -10737,6 +10737,9 @@ msgstr ""
 msgid "Delete comment"
 msgstr ""
 
+msgid "Delete corpus"
+msgstr ""
+
 msgid "Delete domain"
 msgstr ""
 
diff --git a/qa/qa/specs/features/api/1_manage/bulk_import_group_spec.rb b/qa/qa/specs/features/api/1_manage/bulk_import_group_spec.rb
index 2ace3f13217..44d9ede64ae 100644
--- a/qa/qa/specs/features/api/1_manage/bulk_import_group_spec.rb
+++ b/qa/qa/specs/features/api/1_manage/bulk_import_group_spec.rb
@@ -81,7 +81,9 @@ module QA
         Page::Group::BulkImport.perform do |import_page|
           imported_group
 
-          expect { imported_group.import_status }.to eventually_eq('finished').within(duration: 300, interval: 2)
+          expect { imported_group.import_status }.to(
+            eventually_eq('finished').within(max_duration: 300, sleep_interval: 2)
+          )
 
           aggregate_failures do
             expect(imported_group.reload!).to eq(source_group)
diff --git a/qa/qa/specs/features/api/1_manage/import_github_repo_spec.rb b/qa/qa/specs/features/api/1_manage/import_github_repo_spec.rb
index 1b873d35d75..72a0a761294 100644
--- a/qa/qa/specs/features/api/1_manage/import_github_repo_spec.rb
+++ b/qa/qa/specs/features/api/1_manage/import_github_repo_spec.rb
@@ -33,7 +33,7 @@ module QA
       it 'imports Github repo via api', testcase: 'https://gitlab.com/gitlab-org/quality/testcases/-/issues/1858' do
         imported_project # import the project
 
-        expect { imported_project.reload!.import_status }.to eventually_eq('finished').within(duration: 90)
+        expect { imported_project.reload!.import_status }.to eventually_eq('finished').within(max_duration: 90)
 
         aggregate_failures do
           verify_repository_import
diff --git a/qa/qa/specs/features/api/1_manage/import_large_github_repo_spec.rb b/qa/qa/specs/features/api/1_manage/import_large_github_repo_spec.rb
index 50baadf3108..91180993189 100644
--- a/qa/qa/specs/features/api/1_manage/import_large_github_repo_spec.rb
+++ b/qa/qa/specs/features/api/1_manage/import_large_github_repo_spec.rb
@@ -138,7 +138,7 @@ module QA
             raise "Import of '#{imported_project.name}' failed!" if status == 'failed'
           end
         end
-        expect(import_status).to eventually_eq('finished').within(duration: import_max_duration, interval: 30)
+        expect(import_status).to eventually_eq('finished').within(max_duration: import_max_duration, sleep_interval: 30)
         @import_time = Time.now - start
 
         aggregate_failures do
diff --git a/qa/qa/specs/features/browser_ui/7_configure/kubernetes/kubernetes_integration_spec.rb b/qa/qa/specs/features/browser_ui/7_configure/kubernetes/kubernetes_integration_spec.rb
index 1926617fb7e..3a59efe645a 100644
--- a/qa/qa/specs/features/browser_ui/7_configure/kubernetes/kubernetes_integration_spec.rb
+++ b/qa/qa/specs/features/browser_ui/7_configure/kubernetes/kubernetes_integration_spec.rb
@@ -2,7 +2,7 @@
 
 module QA
   RSpec.describe 'Configure', except: { job: 'review-qa-*' } do
-    describe 'Kubernetes Cluster Integration', :requires_admin, :skip_live_env do
+    describe 'Kubernetes Cluster Integration', :requires_admin, :skip_live_env, :smoke do
       context 'Project Clusters' do
         let!(:cluster) { Service::KubernetesCluster.new(provider_class: Service::ClusterProvider::K3s).create! }
         let(:project) do
diff --git a/qa/spec/support/matchers/eventually_matcher.rb b/qa/spec/support/matchers/eventually_matcher.rb
index dc7177cf08a..7a35a3165ae 100644
--- a/qa/spec/support/matchers/eventually_matcher.rb
+++ b/qa/spec/support/matchers/eventually_matcher.rb
@@ -9,7 +9,7 @@
 # expect { Something.that.takes.time.to_appear }.not_to eventually_eq(expected_result)
 #
 # With duration and attempts override
-# expect { Something.that.takes.time.to_appear }.to eventually_eq(expected_result).within(duration: 10, attempts: 5)
+# expect { Something.that.takes.time.to_appear }.to eventually_eq(expected_result).within(max_duration: 10, max_attempts: 5)
 
 module Matchers
   %w[
@@ -21,11 +21,9 @@ module Matchers
     be_empty
   ].each do |op|
     RSpec::Matchers.define(:"eventually_#{op}") do |*expected|
-      chain(:within) do |options = {}|
-        @duration = options[:duration]
-        @attempts = options[:attempts]
-        @interval = options[:interval]
-        @reload_page = options[:reload_page]
+      chain(:within) do |kwargs = {}|
+        @retry_args = kwargs
+        @retry_args[:sleep_interval] = 0.5 unless @retry_args[:sleep_interval]
       end
 
       def supports_block_expectations?
@@ -57,12 +55,7 @@ module Matchers
         attempt = 0
 
         QA::Runtime::Logger.debug("Running eventually matcher with '#{operator_msg}' operator")
-        QA::Support::Retrier.retry_until(
-          max_attempts: @attempts,
-          max_duration: @duration,
-          sleep_interval: @interval || 0.5,
-          reload_page: @reload_page
-        ) do
+        QA::Support::Retrier.retry_until(**@retry_args) do
           QA::Runtime::Logger.debug("evaluating expectation, attempt: #{attempt += 1}")
 
           public_send(expectation_name, actual)
diff --git a/spec/fixtures/api/schemas/graphql/packages/package_details.json b/spec/fixtures/api/schemas/graphql/packages/package_details.json
index 3dfe6712b75..9e8bf7c52d0 100644
--- a/spec/fixtures/api/schemas/graphql/packages/package_details.json
+++ b/spec/fixtures/api/schemas/graphql/packages/package_details.json
@@ -99,6 +99,48 @@
     "status": {
       "type": ["string"],
       "enum": ["DEFAULT", "HIDDEN", "PROCESSING", "ERROR"]
+    },
+    "dependencyLinks": {
+      "type": "object",
+      "additionalProperties": false,
+      "properties": {
+        "pageInfo": { "type": "object" },
+        "edges": { "type": "array" },
+        "nodes": {
+          "type": "array",
+          "items": {
+            "type": "object",
+            "properties": {
+              "id": {
+                "type": "string"
+              },
+              "dependencyType": {
+                "type": "string"
+              },
+              "dependency": {
+                "type": "object",
+                "properties": {
+                  "id": {
+                    "type": "string"
+                  },
+                  "name": {
+                    "type": "string"
+                  },
+                  "versionPattern": {
+                    "type": "string"
+                  }
+                }
+              },
+              "metadata": {
+                "anyOf": [
+                  { "$ref": "./package_nuget_dependency_link_metadata.json" },
+                  { "type": "null" }
+                ]
+              }
+            }
+          }
+        }
+      }
     }
   }
 }
diff --git a/spec/fixtures/api/schemas/graphql/packages/package_nuget_dependency_link_metadata.json b/spec/fixtures/api/schemas/graphql/packages/package_nuget_dependency_link_metadata.json
new file mode 100644
index 00000000000..0738354528e
--- /dev/null
+++ b/spec/fixtures/api/schemas/graphql/packages/package_nuget_dependency_link_metadata.json
@@ -0,0 +1,12 @@
+{
+  "type": "object",
+  "additionalProperties": false,
+  "properties": {
+    "id": {
+      "type": "string"
+    },
+    "targetFramework": {
+      "type": "string"
+    }
+  }
+}
diff --git a/spec/frontend/environments/confirm_rollback_modal_spec.js b/spec/frontend/environments/confirm_rollback_modal_spec.js
index d675726b82b..7ecb6602dc6 100644
--- a/spec/frontend/environments/confirm_rollback_modal_spec.js
+++ b/spec/frontend/environments/confirm_rollback_modal_spec.js
@@ -23,66 +23,73 @@ describe('Confirm Rollback Modal Component', () => {
     commitUrl: 'test/-/commit/abc0123',
   };
 
+  const retryPath = 'test/-/jobs/123/retry';
+
   describe.each`
-    hasMultipleCommits | environmentData
-    ${true}            | ${envWithLastDeployment}
-    ${false}           | ${envWithoutLastDeployment}
-  `('when hasMultipleCommits=$hasMultipleCommits', ({ hasMultipleCommits, environmentData }) => {
-    beforeEach(() => {
-      environment = environmentData;
-    });
+    hasMultipleCommits | environmentData             | retryUrl     | primaryPropsAttrs
+    ${true}            | ${envWithLastDeployment}    | ${null}      | ${[{ variant: 'danger' }]}
+    ${false}           | ${envWithoutLastDeployment} | ${retryPath} | ${[{ variant: 'danger' }, { 'data-method': 'post' }, { href: retryPath }]}
+  `(
+    'when hasMultipleCommits=$hasMultipleCommits',
+    ({ hasMultipleCommits, environmentData, retryUrl, primaryPropsAttrs }) => {
+      beforeEach(() => {
+        environment = environmentData;
+      });
 
-    it('should show "Rollback" when isLastDeployment is false', () => {
-      const component = shallowMount(ConfirmRollbackModal, {
-        propsData: {
-          environment: {
-            ...environment,
-            isLastDeployment: false,
+      it('should show "Rollback" when isLastDeployment is false', () => {
+        const component = shallowMount(ConfirmRollbackModal, {
+          propsData: {
+            environment: {
+              ...environment,
+              isLastDeployment: false,
+            },
+            hasMultipleCommits,
+            retryUrl,
           },
-          hasMultipleCommits,
-        },
+        });
+        const modal = component.find(GlModal);
+
+        expect(modal.attributes('title')).toContain('Rollback');
+        expect(modal.attributes('title')).toContain('test');
+        expect(modal.props('actionPrimary').text).toBe('Rollback');
+        expect(modal.props('actionPrimary').attributes).toEqual(primaryPropsAttrs);
+        expect(modal.text()).toContain('commit abc0123');
+        expect(modal.text()).toContain('Are you sure you want to continue?');
       });
-      const modal = component.find(GlModal);
 
-      expect(modal.attributes('title')).toContain('Rollback');
-      expect(modal.attributes('title')).toContain('test');
-      expect(modal.attributes('ok-title')).toBe('Rollback');
-      expect(modal.text()).toContain('commit abc0123');
-      expect(modal.text()).toContain('Are you sure you want to continue?');
-    });
-
-    it('should show "Re-deploy" when isLastDeployment is true', () => {
-      const component = shallowMount(ConfirmRollbackModal, {
-        propsData: {
-          environment: {
-            ...environment,
-            isLastDeployment: true,
+      it('should show "Re-deploy" when isLastDeployment is true', () => {
+        const component = shallowMount(ConfirmRollbackModal, {
+          propsData: {
+            environment: {
+              ...environment,
+              isLastDeployment: true,
+            },
+            hasMultipleCommits,
           },
-          hasMultipleCommits,
-        },
+        });
+        const modal = component.find(GlModal);
+
+        expect(modal.attributes('title')).toContain('Re-deploy');
+        expect(modal.attributes('title')).toContain('test');
+        expect(modal.props('actionPrimary').text).toBe('Re-deploy');
+        expect(modal.text()).toContain('commit abc0123');
+        expect(modal.text()).toContain('Are you sure you want to continue?');
       });
-      const modal = component.find(GlModal);
 
-      expect(modal.attributes('title')).toContain('Re-deploy');
-      expect(modal.attributes('title')).toContain('test');
-      expect(modal.attributes('ok-title')).toBe('Re-deploy');
-      expect(modal.text()).toContain('commit abc0123');
-      expect(modal.text()).toContain('Are you sure you want to continue?');
-    });
+      it('should emit the "rollback" event when "ok" is clicked', () => {
+        const env = { ...environmentData, isLastDeployment: true };
+        const component = shallowMount(ConfirmRollbackModal, {
+          propsData: {
+            environment: env,
+            hasMultipleCommits,
+          },
+        });
+        const eventHubSpy = jest.spyOn(eventHub, '$emit');
+        const modal = component.find(GlModal);
+        modal.vm.$emit('ok');
 
-    it('should emit the "rollback" event when "ok" is clicked', () => {
-      const env = { ...environmentData, isLastDeployment: true };
-      const component = shallowMount(ConfirmRollbackModal, {
-        propsData: {
-          environment: env,
-          hasMultipleCommits,
-        },
+        expect(eventHubSpy).toHaveBeenCalledWith('rollbackEnvironment', env);
       });
-      const eventHubSpy = jest.spyOn(eventHub, '$emit');
-      const modal = component.find(GlModal);
-      modal.vm.$emit('ok');
-
-      expect(eventHubSpy).toHaveBeenCalledWith('rollbackEnvironment', env);
-    });
-  });
+    },
+  );
 });
diff --git a/spec/frontend/packages_and_registries/package_registry/components/details/__snapshots__/version_row_spec.js.snap b/spec/frontend/packages_and_registries/package_registry/components/details/__snapshots__/version_row_spec.js.snap
new file mode 100644
index 00000000000..8f69f943112
--- /dev/null
+++ b/spec/frontend/packages_and_registries/package_registry/components/details/__snapshots__/version_row_spec.js.snap
@@ -0,0 +1,101 @@
+// Jest Snapshot v1, https://goo.gl/fbAQLP
+
+exports[`VersionRow renders 1`] = `
+<div
+  class="gl-display-flex gl-flex-direction-column gl-border-b-solid gl-border-t-solid gl-border-t-1 gl-border-b-1 gl-border-t-transparent gl-border-b-gray-100"
+>
+  <div
+    class="gl-display-flex gl-align-items-center gl-py-3 gl-px-5"
+  >
+    <!---->
+     
+    <div
+      class="gl-display-flex gl-xs-flex-direction-column gl-justify-content-space-between gl-align-items-stretch gl-flex-grow-1"
+    >
+      <div
+        class="gl-display-flex gl-flex-direction-column gl-xs-mb-3 gl-min-w-0 gl-flex-grow-1"
+      >
+        <div
+          class="gl-display-flex gl-align-items-center gl-text-body gl-font-weight-bold gl-min-h-6 gl-min-w-0"
+        >
+          <div
+            class="gl-display-flex gl-align-items-center gl-mr-3 gl-min-w-0"
+          >
+            <gl-link-stub
+              class="gl-text-body gl-min-w-0"
+              href="243"
+            >
+              <span
+                class="gl-truncate"
+                title="@gitlab-org/package-15"
+              >
+                <span
+                  class="gl-truncate-end"
+                >
+                  @gitlab-org/package-15
+                </span>
+              </span>
+            </gl-link-stub>
+             
+            <package-tags-stub
+              class="gl-ml-3"
+              hidelabel="true"
+              tagdisplaylimit="1"
+              tags="[object Object],[object Object],[object Object]"
+            />
+          </div>
+           
+          <!---->
+        </div>
+         
+        <div
+          class="gl-display-flex gl-align-items-center gl-text-gray-500 gl-min-h-6 gl-min-w-0 gl-flex-grow-1"
+        >
+          
+    1.0.1
+  
+        </div>
+      </div>
+       
+      <div
+        class="gl-display-flex gl-flex-direction-column gl-sm-align-items-flex-end gl-justify-content-space-between gl-text-gray-500 gl-flex-shrink-0"
+      >
+        <div
+          class="gl-display-flex gl-align-items-center gl-sm-text-body gl-sm-font-weight-bold gl-min-h-6"
+        >
+          <publish-method-stub
+            packageentity="[object Object]"
+          />
+        </div>
+         
+        <div
+          class="gl-display-flex gl-align-items-center gl-min-h-6"
+        >
+          Created 
+          <time-ago-tooltip-stub
+            cssclass=""
+            time="2021-08-10T09:33:54Z"
+            tooltipplacement="top"
+          />
+        </div>
+      </div>
+    </div>
+     
+    <!---->
+  </div>
+   
+  <div
+    class="gl-display-flex"
+  >
+    <div
+      class="gl-w-7"
+    />
+     
+    <!---->
+     
+    <div
+      class="gl-w-9"
+    />
+  </div>
+</div>
+`;
diff --git a/spec/frontend/packages_and_registries/package_registry/components/details/app_spec.js b/spec/frontend/packages_and_registries/package_registry/components/details/app_spec.js
index e5155a8e140..1bd2058cf5b 100644
--- a/spec/frontend/packages_and_registries/package_registry/components/details/app_spec.js
+++ b/spec/frontend/packages_and_registries/package_registry/components/details/app_spec.js
@@ -14,6 +14,7 @@ import InstallationCommands from '~/packages_and_registries/package_registry/com
 import PackageFiles from '~/packages_and_registries/package_registry/components/details/package_files.vue';
 import PackageHistory from '~/packages_and_registries/package_registry/components/details/package_history.vue';
 import PackageTitle from '~/packages_and_registries/package_registry/components/details/package_title.vue';
+import VersionRow from '~/packages_and_registries/package_registry/components/details/version_row.vue';
 import {
   FETCH_PACKAGE_DETAILS_ERROR_MESSAGE,
   DELETE_PACKAGE_ERROR_MESSAGE,
@@ -28,6 +29,7 @@ import getPackageDetails from '~/packages_and_registries/package_registry/graphq
 import {
   packageDetailsQuery,
   packageData,
+  packageVersions,
   emptyPackageDetailsQuery,
   packageDestroyMutation,
   packageDestroyMutationError,
@@ -96,6 +98,8 @@ describe('PackagesApp', () => {
   const findDeleteButton = () => wrapper.findByTestId('delete-package');
   const findPackageFiles = () => wrapper.findComponent(PackageFiles);
   const findDeleteFileModal = () => wrapper.findByTestId('delete-file-modal');
+  const findVersionRows = () => wrapper.findAllComponents(VersionRow);
+  const noVersionsMessage = () => wrapper.findByTestId('no-versions-message');
 
   afterEach(() => {
     wrapper.destroy();
@@ -362,4 +366,39 @@ describe('PackagesApp', () => {
       });
     });
   });
+
+  describe('versions', () => {
+    it('displays the correct version count when the package has versions', async () => {
+      createComponent();
+
+      await waitForPromises();
+
+      expect(findVersionRows()).toHaveLength(packageVersions().length);
+    });
+
+    it('binds the correct props', async () => {
+      const [versionPackage] = packageVersions();
+      // eslint-disable-next-line no-underscore-dangle
+      delete versionPackage.__typename;
+      delete versionPackage.tags;
+
+      createComponent();
+
+      await waitForPromises();
+
+      expect(findVersionRows().at(0).props()).toMatchObject({
+        packageEntity: expect.objectContaining(versionPackage),
+      });
+    });
+
+    it('displays the no versions message when there are none', async () => {
+      createComponent({
+        resolver: jest.fn().mockResolvedValue(packageDetailsQuery({ versions: { nodes: [] } })),
+      });
+
+      await waitForPromises();
+
+      expect(noVersionsMessage().exists()).toBe(true);
+    });
+  });
 });
diff --git a/spec/frontend/packages_and_registries/package_registry/components/details/version_row_spec.js b/spec/frontend/packages_and_registries/package_registry/components/details/version_row_spec.js
new file mode 100644
index 00000000000..f7613949fe4
--- /dev/null
+++ b/spec/frontend/packages_and_registries/package_registry/components/details/version_row_spec.js
@@ -0,0 +1,89 @@
+import { GlLink, GlSprintf, GlTruncate } from '@gitlab/ui';
+import { shallowMountExtended } from 'helpers/vue_test_utils_helper';
+import { getIdFromGraphQLId } from '~/graphql_shared/utils';
+import PackageTags from '~/packages/shared/components/package_tags.vue';
+import PublishMethod from '~/packages/shared/components/publish_method.vue';
+import VersionRow from '~/packages_and_registries/package_registry/components/details/version_row.vue';
+import ListItem from '~/vue_shared/components/registry/list_item.vue';
+import TimeAgoTooltip from '~/vue_shared/components/time_ago_tooltip.vue';
+
+import { packageVersions } from '../../mock_data';
+
+const packageVersion = packageVersions()[0];
+
+describe('VersionRow', () => {
+  let wrapper;
+
+  const findListItem = () => wrapper.findComponent(ListItem);
+  const findLink = () => wrapper.findComponent(GlLink);
+  const findPackageTags = () => wrapper.findComponent(PackageTags);
+  const findPublishMethod = () => wrapper.findComponent(PublishMethod);
+  const findTimeAgoTooltip = () => wrapper.findComponent(TimeAgoTooltip);
+
+  function createComponent(packageEntity = packageVersion) {
+    wrapper = shallowMountExtended(VersionRow, {
+      propsData: {
+        packageEntity,
+      },
+      stubs: {
+        ListItem,
+        GlSprintf,
+        GlTruncate,
+      },
+    });
+  }
+
+  afterEach(() => {
+    wrapper.destroy();
+  });
+
+  it('renders', () => {
+    createComponent();
+
+    expect(wrapper.element).toMatchSnapshot();
+  });
+
+  it('has a link to the version detail', () => {
+    createComponent();
+
+    expect(findLink().attributes('href')).toBe(`${getIdFromGraphQLId(packageVersion.id)}`);
+    expect(findLink().text()).toBe(packageVersion.name);
+  });
+
+  it('has the version of the package', () => {
+    createComponent();
+
+    expect(wrapper.text()).toContain(packageVersion.version);
+  });
+
+  it('has a package tags component', () => {
+    createComponent();
+
+    expect(findPackageTags().props('tags')).toBe(packageVersion.tags.nodes);
+  });
+
+  it('has a publish method component', () => {
+    createComponent();
+
+    expect(findPublishMethod().props('packageEntity')).toBe(packageVersion);
+  });
+  it('has a time-ago tooltip', () => {
+    createComponent();
+
+    expect(findTimeAgoTooltip().props('time')).toBe(packageVersion.createdAt);
+  });
+
+  describe('disabled status', () => {
+    it('disables the list item', () => {
+      createComponent({ ...packageVersion, status: 'something' });
+
+      expect(findListItem().props('disabled')).toBe(true);
+    });
+
+    it('disables the link', () => {
+      createComponent({ ...packageVersion, status: 'something' });
+
+      expect(findLink().attributes('disabled')).toBe('true');
+    });
+  });
+});
diff --git a/spec/frontend/packages_and_registries/package_registry/mock_data.js b/spec/frontend/packages_and_registries/package_registry/mock_data.js
index 5cf81e5cd09..9e5457aa0fe 100644
--- a/spec/frontend/packages_and_registries/package_registry/mock_data.js
+++ b/spec/frontend/packages_and_registries/package_registry/mock_data.js
@@ -51,6 +51,27 @@ export const packageFiles = () => [
   },
 ];
 
+export const packageVersions = () => [
+  {
+    createdAt: '2021-08-10T09:33:54Z',
+    id: 'gid://gitlab/Packages::Package/243',
+    name: '@gitlab-org/package-15',
+    status: 'DEFAULT',
+    tags: { nodes: packageTags() },
+    version: '1.0.1',
+    __typename: 'Package',
+  },
+  {
+    createdAt: '2021-08-10T09:33:54Z',
+    id: 'gid://gitlab/Packages::Package/244',
+    name: '@gitlab-org/package-15',
+    status: 'DEFAULT',
+    tags: { nodes: packageTags() },
+    version: '1.0.2',
+    __typename: 'Package',
+  },
+];
+
 export const packageData = (extend) => ({
   id: 'gid://gitlab/Packages::Package/111',
   name: '@gitlab-org/package-15',
@@ -105,6 +126,9 @@ export const packageDetailsQuery = (extendPackage) => ({
         ...mavenMetadata(),
         ...nugetMetadata(),
       },
+      project: {
+        path: 'projectPath',
+      },
       tags: {
         nodes: packageTags(),
         __typename: 'PackageTagConnection',
@@ -117,6 +141,10 @@ export const packageDetailsQuery = (extendPackage) => ({
         nodes: packageFiles(),
         __typename: 'PackageFileConnection',
       },
+      versions: {
+        nodes: packageVersions(),
+        __typename: 'PackageConnection',
+      },
       __typename: 'PackageDetailsType',
       ...extendPackage,
     },
diff --git a/spec/graphql/types/packages/nuget/dependency_link_metdatum_type_spec.rb b/spec/graphql/types/packages/nuget/dependency_link_metdatum_type_spec.rb
new file mode 100644
index 00000000000..b11d9d131aa
--- /dev/null
+++ b/spec/graphql/types/packages/nuget/dependency_link_metdatum_type_spec.rb
@@ -0,0 +1,13 @@
+# frozen_string_literal: true
+
+require 'spec_helper'
+
+RSpec.describe GitlabSchema.types['NugetDependencyLinkMetadata'] do
+  it 'includes nuget dependency link metadatum fields' do
+    expected_fields = %w[
+      id target_framework
+    ]
+
+    expect(described_class).to include_graphql_fields(*expected_fields)
+  end
+end
diff --git a/spec/graphql/types/packages/package_dependency_link_type_spec.rb b/spec/graphql/types/packages/package_dependency_link_type_spec.rb
new file mode 100644
index 00000000000..53ee8be69a6
--- /dev/null
+++ b/spec/graphql/types/packages/package_dependency_link_type_spec.rb
@@ -0,0 +1,13 @@
+# frozen_string_literal: true
+
+require 'spec_helper'
+
+RSpec.describe GitlabSchema.types['PackageDependencyLink'] do
+  it 'includes package file fields' do
+    expected_fields = %w[
+      id dependency_type dependency metadata
+    ]
+
+    expect(described_class).to include_graphql_fields(*expected_fields)
+  end
+end
diff --git a/spec/graphql/types/packages/package_dependency_type_enum_spec.rb b/spec/graphql/types/packages/package_dependency_type_enum_spec.rb
new file mode 100644
index 00000000000..b8893a3619e
--- /dev/null
+++ b/spec/graphql/types/packages/package_dependency_type_enum_spec.rb
@@ -0,0 +1,9 @@
+# frozen_string_literal: true
+
+require 'spec_helper'
+
+RSpec.describe GitlabSchema.types['PackageDependencyType'] do
+  it 'exposes all depeendency type values' do
+    expect(described_class.values.keys).to contain_exactly(*%w[DEPENDENCIES DEV_DEPENDENCIES BUNDLE_DEPENDENCIES PEER_DEPENDENCIES])
+  end
+end
diff --git a/spec/graphql/types/packages/package_dependency_type_spec.rb b/spec/graphql/types/packages/package_dependency_type_spec.rb
new file mode 100644
index 00000000000..67474729781
--- /dev/null
+++ b/spec/graphql/types/packages/package_dependency_type_spec.rb
@@ -0,0 +1,13 @@
+# frozen_string_literal: true
+
+require 'spec_helper'
+
+RSpec.describe GitlabSchema.types['PackageDependency'] do
+  it 'includes package file fields' do
+    expected_fields = %w[
+      id name version_pattern
+    ]
+
+    expect(described_class).to include_graphql_fields(*expected_fields)
+  end
+end
diff --git a/spec/graphql/types/packages/package_details_type_spec.rb b/spec/graphql/types/packages/package_details_type_spec.rb
index 06093813315..7e1103d8aa0 100644
--- a/spec/graphql/types/packages/package_details_type_spec.rb
+++ b/spec/graphql/types/packages/package_details_type_spec.rb
@@ -5,7 +5,7 @@ require 'spec_helper'
 RSpec.describe GitlabSchema.types['PackageDetailsType'] do
   it 'includes all the package fields' do
     expected_fields = %w[
-      id name version created_at updated_at package_type tags project pipelines versions package_files
+      id name version created_at updated_at package_type tags project pipelines versions package_files dependency_links
     ]
 
     expect(described_class).to include_graphql_fields(*expected_fields)
diff --git a/spec/initializers/rails_asset_host_spec.rb b/spec/initializers/rails_asset_host_spec.rb
index 682ef9d9bbe..eb69c1fa85b 100644
--- a/spec/initializers/rails_asset_host_spec.rb
+++ b/spec/initializers/rails_asset_host_spec.rb
@@ -7,6 +7,15 @@ RSpec.describe 'Rails asset host initializer' do
     load Rails.root.join('config/initializers/rails_asset_host.rb')
   end
 
+  around do |example|
+    old_asset_host = Rails.application.config.action_controller.asset_host
+
+    example.run
+
+    Rails.application.config.action_controller.asset_host = old_asset_host
+    ActionController::Base.asset_host = old_asset_host
+  end
+
   subject { Rails.application.config.action_controller.asset_host }
 
   it 'uses no asset host by default' do
diff --git a/spec/lib/gitlab/ci/config/entry/job_spec.rb b/spec/lib/gitlab/ci/config/entry/job_spec.rb
index 01a890cacd3..5b47d3a3922 100644
--- a/spec/lib/gitlab/ci/config/entry/job_spec.rb
+++ b/spec/lib/gitlab/ci/config/entry/job_spec.rb
@@ -434,20 +434,6 @@ RSpec.describe Gitlab::Ci::Config::Entry::Job do
             expect(entry.errors).to include 'job dependencies the another-job should be part of needs'
           end
         end
-
-        context 'when stage: is missing' do
-          let(:config) do
-            {
-              script: 'echo',
-              needs: ['build-job']
-            }
-          end
-
-          it 'returns error about invalid data' do
-            expect(entry).not_to be_valid
-            expect(entry.errors).to include 'job config missing required keys: stage'
-          end
-        end
       end
 
       context 'when timeout value is not correct' do
diff --git a/spec/requests/api/graphql/packages/nuget_spec.rb b/spec/requests/api/graphql/packages/nuget_spec.rb
index 1de16009684..ba8d2ca42d2 100644
--- a/spec/requests/api/graphql/packages/nuget_spec.rb
+++ b/spec/requests/api/graphql/packages/nuget_spec.rb
@@ -6,8 +6,11 @@ RSpec.describe 'nuget package details' do
   include_context 'package details setup'
 
   let_it_be(:package) { create(:nuget_package, :with_metadatum, project: project) }
+  let_it_be(:dependency_link) { create(:packages_dependency_link, :with_nuget_metadatum, package: package) }
 
   let(:metadata) { query_graphql_fragment('NugetMetadata') }
+  let(:dependency_link_response) { graphql_data_at(:package, :dependency_links, :nodes, 0) }
+  let(:dependency_response) { graphql_data_at(:package, :dependency_links, :nodes, 0, :dependency) }
 
   subject { post_graphql(query, current_user: user) }
 
@@ -26,4 +29,34 @@ RSpec.describe 'nuget package details' do
       'iconUrl' => package.nuget_metadatum.icon_url
     )
   end
+
+  it 'has dependency links' do
+    expect(dependency_link_response).to include(
+      'id' => global_id_of(dependency_link),
+      'dependencyType' => dependency_link.dependency_type.upcase
+    )
+
+    expect(dependency_response).to include(
+      'id' => global_id_of(dependency_link.dependency),
+      'name' => dependency_link.dependency.name,
+      'versionPattern' => dependency_link.dependency.version_pattern
+    )
+  end
+
+  it 'avoids N+1 queries' do
+    first_user = create(:user)
+    second_user = create(:user)
+
+    control_count = ActiveRecord::QueryRecorder.new do
+      post_graphql(query, current_user: first_user)
+    end
+
+    create_list(:packages_dependency_link, 10, :with_nuget_metadatum, package: package)
+
+    expect do
+      post_graphql(query, current_user: second_user)
+    end.not_to exceed_query_limit(control_count)
+
+    expect(response).to have_gitlab_http_status(:ok)
+  end
 end
diff --git a/spec/support/shared_contexts/graphql/requests/packages_shared_context.rb b/spec/support/shared_contexts/graphql/requests/packages_shared_context.rb
index 334b11c9f6e..645ea742f07 100644
--- a/spec/support/shared_contexts/graphql/requests/packages_shared_context.rb
+++ b/spec/support/shared_contexts/graphql/requests/packages_shared_context.rb
@@ -9,6 +9,7 @@ RSpec.shared_context 'package details setup' do
   let(:depth) { 3 }
   let(:excluded) { %w[metadata apiFuzzingCiConfiguration pipeline packageFiles] }
   let(:package_files) { all_graphql_fields_for('PackageFile') }
+  let(:dependency_links) { all_graphql_fields_for('PackageDependencyLink') }
   let(:user) { project.owner }
   let(:package_details) { graphql_data_at(:package) }
   let(:metadata_response) { graphql_data_at(:package, :metadata) }
@@ -28,6 +29,11 @@ RSpec.shared_context 'package details setup' do
         #{package_files}
       }
     }
+    dependencyLinks {
+      nodes {
+        #{dependency_links}
+      }
+    }
     FIELDS
   end
 end